Website in active development. More updates coming in March 2026.
TLDWP

Domain Details for l*t*h*i*l*p*r*d*s*r*c*.com

WordPress Version: Unknown

Theme: litchfieldpark-twentytwentythree

Last Checked: 2025-11-08 21:27:02

Plugins (4)

Plugin Used By
booking-calendar-pro 53
contact-form-7 4,157,339
megamenu 166,345
wpcf7-redirect 129,293

✅ No Immediate Security Risks Found

Our automated scan did not detect any of the most common publicly-accessible vulnerabilities on this domain.

However, this doesn't mean the site is completely secure. There are many other potential vulnerabilities that require deeper analysis:

  • Outdated WordPress core, themes, or plugins
  • Weak passwords and authentication
  • Missing security headers
  • SQL injection vulnerabilities
  • Cross-site scripting (XSS) issues
  • Insecure server configurations

Questions about your WordPress security? Reach out — we offer comprehensive security audits and can help identify hidden vulnerabilities.

Top 50 Plugins

Plugin Count
elementor 5,058,809
contact-form-7 4,157,338
elementor-pro 2,778,569
woocommerce 2,475,057
revslider 1,630,676
js_composer 1,006,145
essential-addons-for-elementor-lite 745,340
wp-rocket 712,018
header-footer-elementor 688,715
elementskit-lite 662,575
jetpack 605,806
google-analytics-for-wordpress 530,878
instagram-feed 517,173
gutenberg-core 513,182
wpforms-lite 509,911
astra-sites 509,445
google-site-kit 505,969
cookie-law-info 472,690
complianz-gdpr 454,136
litespeed-cache 436,832
gravityforms 435,545
sitepress-multilingual-cms 386,908
bluehost-wordpress-plugin 370,239
gtranslate 320,855
cookie-notice 276,580
coblocks 265,801
mailchimp-for-wp 251,364
premium-addons-for-elementor 249,633
sg-cachepress 240,358
pro-elements 234,547
astra-addon 232,893
click-to-chat-for-whatsapp 230,642
bb-plugin 227,551
the-events-calendar 227,188
creame-whatsapp-me 225,861
layerslider 214,239
wp-smushit 212,840
royal-elementor-addons 204,184
popup-maker 198,549
ultimate-addons-for-gutenberg 196,757
custom-fonts 191,544
tablepress 188,744
pixelyoursite 186,518
woocommerce-gateway-stripe 186,091
smart-slider-3 183,391
gutenberg 182,499
duracelltomi-google-tag-manager 176,183
metform 173,179
cleantalk-spam-protect 170,262
jet-engine 169,505

Top 50 Themes

Theme Count
hello-elementor 1,339,744
astra 1,228,240
Divi 1,069,137
pub 309,755
generatepress 253,426
flatsome 247,828
h4 225,253
Avada 210,306
oceanwp 184,847
kadence 159,484
twentytwentyfive 140,229
bb-theme 135,384
blocksy 133,894
twentytwentyfour 129,681
enfold 127,705
cocoon-master 127,150
salient 124,516
woodmart 112,199
betheme 107,403
twentyseventeen 95,057
dt-the7 84,423
neve 75,765
swell 68,641
twentytwentyone 64,752
bridge 63,824
lightning 57,484
twentytwentythree 57,214
twentytwenty 53,485
Avada-Child-Theme 46,338
Impreza 43,571
gox 43,290
bricks 42,639
Newspaper 42,292
twentytwentytwo 41,716
yith-wonder 35,743
storefront 34,032
themify-ultra 33,644
extendable 33,159
twentyfifteen 32,894
pro 32,476
uncode 31,959
sydney 31,251
epik-redesign 30,777
twentysixteen 30,754
go 29,390
porto 27,931
Total 27,596
hestia 25,030
popularfx 24,164
thrive-theme 23,400