Site Information
WordPress Version: 7.0 VULNERABLE
Theme: litchfieldpark-twentytwentythree
Last Checked: 2026-07-09 07:10:07
HTTPS: Yes
Plugins (4)
| Plugin | Used By |
|---|---|
| booking-calendar-pro | 35 |
| contact-form-7 | 1,751,374 |
| megamenu | 80,206 |
| wpcf7-redirect | 55,750 |
Security Headers
D
Grade D
4 missing headers
Exposed Files & Configurations
This domain has publicly accessible security-sensitive files or configurations:
- Vulnerable WordPress Version (7.0) — wp2shell unauthenticated RCE (CVE-2026-63030). Update to 7.0.2 immediately.
- User enumeration exposed — Usernames are publicly discoverable via the REST API or author archives, aiding brute-force attacks ?
Need help securing your WordPress site? Contact us for a professional security audit.