WordPress Version: Unknown
Theme: litchfieldpark-twentytwentythree
Last Checked: 2025-11-08 21:27:02
Plugins (4)
| Plugin | Used By |
|---|---|
| booking-calendar-pro | 53 |
| contact-form-7 | 4,158,131 |
| megamenu | 166,255 |
| wpcf7-redirect | 129,233 |
✅ No Immediate Security Risks Found
Our automated scan did not detect any of the most common publicly-accessible vulnerabilities on this domain.
However, this doesn't mean the site is completely secure. There are many other potential vulnerabilities that require deeper analysis:
- Outdated WordPress core, themes, or plugins
- Weak passwords and authentication
- Missing security headers
- SQL injection vulnerabilities
- Cross-site scripting (XSS) issues
- Insecure server configurations
Questions about your WordPress security? Reach out — we offer comprehensive security audits and can help identify hidden vulnerabilities.