Website in active development. More updates coming in January 2026.
TLDWP

Domain Details for l*t*h*i*l*p*r*d*s*r*c*.com

WordPress Version: Unknown

Theme: litchfieldpark-twentytwentythree

Last Checked: 2025-11-08 21:27:02

Plugins (4)

Plugin Used By
booking-calendar-pro 53
contact-form-7 4,158,131
megamenu 166,255
wpcf7-redirect 129,233

✅ No Immediate Security Risks Found

Our automated scan did not detect any of the most common publicly-accessible vulnerabilities on this domain.

However, this doesn't mean the site is completely secure. There are many other potential vulnerabilities that require deeper analysis:

  • Outdated WordPress core, themes, or plugins
  • Weak passwords and authentication
  • Missing security headers
  • SQL injection vulnerabilities
  • Cross-site scripting (XSS) issues
  • Insecure server configurations

Questions about your WordPress security? Reach out — we offer comprehensive security audits and can help identify hidden vulnerabilities.

Top 50 Plugins

Plugin Count
elementor 5,056,630
contact-form-7 4,158,131
elementor-pro 2,776,844
woocommerce 2,475,076
revslider 1,631,825
js_composer 1,006,993
essential-addons-for-elementor-lite 744,174
wp-rocket 711,751
header-footer-elementor 688,300
elementskit-lite 662,324
jetpack 591,599
google-analytics-for-wordpress 531,410
instagram-feed 517,057
wpforms-lite 513,382
gutenberg-core 512,789
astra-sites 509,156
google-site-kit 501,554
cookie-law-info 472,353
complianz-gdpr 453,298
litespeed-cache 436,459
gravityforms 430,945
sitepress-multilingual-cms 387,007
bluehost-wordpress-plugin 368,787
gtranslate 320,302
cookie-notice 277,567
coblocks 264,954
mailchimp-for-wp 252,186
premium-addons-for-elementor 250,126
sg-cachepress 240,409
pro-elements 234,087
astra-addon 232,733
click-to-chat-for-whatsapp 230,225
bb-plugin 227,589
the-events-calendar 226,863
creame-whatsapp-me 225,403
layerslider 214,501
wp-smushit 212,857
royal-elementor-addons 203,888
ultimate-addons-for-gutenberg 196,858
popup-maker 195,481
custom-fonts 191,528
tablepress 188,629
pixelyoursite 186,541
woocommerce-gateway-stripe 185,540
smart-slider-3 183,410
gutenberg 181,618
duracelltomi-google-tag-manager 175,948
metform 172,934
cleantalk-spam-protect 170,147
jet-engine 169,216

Top 50 Themes

Theme Count
hello-elementor 1,386,459
astra 1,275,558
Divi 1,105,591
pub 309,721
flatsome 270,833
generatepress 263,372
h4 225,634
Avada 215,286
oceanwp 190,718
kadence 165,551
twentytwentyfive 151,694
bb-theme 139,083
blocksy 138,778
twentytwentyfour 133,318
enfold 131,392
salient 128,117
cocoon-master 127,820
woodmart 124,855
betheme 111,429
twentyseventeen 96,876
dt-the7 87,228
neve 78,131
swell 68,954
twentytwentyone 66,164
bridge 66,134
twentytwentythree 58,485
lightning 57,817
twentytwenty 54,805
Avada-Child-Theme 47,099
Impreza 45,173
bricks 44,233
gox 43,570
Newspaper 43,537
twentytwentytwo 42,459
yith-wonder 37,382
storefront 35,226
extendable 35,002
epik-redesign 34,565
themify-ultra 34,540
twentyfifteen 33,341
pro 33,297
uncode 32,858
sydney 32,099
twentysixteen 31,427
go 29,684
porto 29,270
Total 28,377
popularfx 25,881
hestia 25,715
thrive-theme 24,004