Site Information
WordPress Version: 6.9.4 ✓
Theme: litchfieldpark-twentytwentythree
Last Checked: 2026-05-12 07:19:44
HTTPS: ✅ Yes
Plugins (4)
| Plugin | Used By |
|---|---|
| booking-calendar-pro | 41 |
| contact-form-7 | 1,739,229 |
| megamenu | 79,695 |
| wpcf7-redirect | 55,802 |
Security Headers
4 missing headers
Exposed Files & Configurations
✅ No Exposed Files Detected
Our automated scan did not detect any publicly-accessible sensitive files or critical misconfigurations on this domain.
However, this doesn't mean the site is completely secure. There are many other potential vulnerabilities that require deeper analysis:
- Outdated WordPress core, themes, or plugins
- Weak passwords and authentication
- SQL injection vulnerabilities
- Cross-site scripting (XSS) issues
- Insecure server configurations
Questions about your WordPress security? Reach out — we offer comprehensive security audits and can help identify hidden vulnerabilities.